Name | PRMT8 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55401 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PRMT8(protein arginine methyltransferase 8) The peptide sequence was selected from the C terminal of PRMT8 (NP_872294). Peptide sequence YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | PRMT8 |
Conjugate | Unconjugated |
Supplier Page | Shop |