PRMT8 Antibody
| Name | PRMT8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55401 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PRMT8(protein arginine methyltransferase 8) The peptide sequence was selected from the C terminal of PRMT8 (NP_872294). Peptide sequence YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | PRMT8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PRMT8 Antibody [NBP1-55401] - Lanes: 1 : 30ug HeLa lysate, 2: 30ug HFF lysate, 3: 30ug U2OS lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: PRMT8.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7176_PRMT8%2520Antibody-Western%2520Blot-NBP1-55401-img0004.jpg)
Western Blot: PRMT8 Antibody [NBP1-55401] - Lanes: 1 : 30ug HeLa lysate, 2: 30ug HFF lysate, 3: 30ug U2OS lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: PRMT8.
![Western Blot: PRMT8 Antibody [NBP1-55401] - Transfected 293T cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7177_PRMT8-Antibody-Western-Blot-NBP1-55401-img0003.jpg)
Western Blot: PRMT8 Antibody [NBP1-55401] - Transfected 293T cell lysate, concentration 2.5 ug/ml.