Name | C20orf160 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70461 |
Prices | $139.00, $153.00, $329.00, $362.00 |
Sizes | 20 µl, 20 µl, 100 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to C20ORF160 The peptide sequence was selected from the N terminal of C20ORF160. Peptide sequence LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CCM2L |
Conjugate | Unconjugated |
Supplier Page | Shop |