C20orf160 Antibody

Name C20orf160 Antibody
Supplier Novus Biologicals
Catalog NBP1-70461
Prices $139.00, $153.00, $329.00, $362.00
Sizes 20 µl, 20 µl, 100 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C20ORF160 The peptide sequence was selected from the N terminal of C20ORF160. Peptide sequence LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCM2L
Conjugate Unconjugated
Supplier Page Shop

Product images