| Name | CSAP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70458 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C1orf96 (chromosome 1 open reading frame 96) The peptide sequence was selected from the middle region of C1orf96. Peptide sequence ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CCSAP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |