C1orf110 Antibody
| Name | C1orf110 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70449 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C1ORF110 The peptide sequence was selected from the middle region of C1ORF110. Peptide sequence SKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C1orf110 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C1orf110 Antibody [NBP1-70449] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16548_C1orf110%2520Antibody-Western%2520Blot-NBP1-70449-img0002.jpg)
Western Blot: C1orf110 Antibody [NBP1-70449] - Hela cell lysate, concentration 0.2-1 ug/ml.