C1orf110 Antibody

Name C1orf110 Antibody
Supplier Novus Biologicals
Catalog NBP1-70448
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C1ORF110 The peptide sequence was selected from the N terminal of C1ORF110. Peptide sequence LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C1orf110
Conjugate Unconjugated
Supplier Page Shop

Product images