C17orf97 Antibody

Name C17orf97 Antibody
Supplier Novus Biologicals
Catalog NBP1-70443
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LOC400566(hypothetical gene supported by AK128660) The peptide sequence was selected from the N terminal of LOC400566. Peptide sequence VSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C17orf97
Conjugate Unconjugated
Supplier Page Shop

Product images