BEND7 Antibody

Name BEND7 Antibody
Supplier Novus Biologicals
Catalog NBP1-70420
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to BEND7 (BEN domain containing 7) The peptide sequence was selected from the middle region of BEND7. Peptide sequence LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene BEND7
Supplier Page Shop

Product images