CEACAM16 Antibody

Name CEACAM16 Antibody
Supplier Novus Biologicals
Catalog NBP1-70492
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CEACAM16(carcinoembryonic antigen-related cell adhesion molecule 16) The peptide sequence was selected from the middle region of CEACAM16. Peptide sequence TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGF
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CEACAM16
Conjugate Unconjugated
Supplier Page Shop

Product images