MON1A Antibody

Name MON1A Antibody
Supplier Novus Biologicals
Catalog NBP1-74123
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the C terminal of MON1A. Immunizing peptide sequence GIPDLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MON1A
Conjugate Unconjugated
Supplier Page Shop

Product images