SETD5 Antibody
| Name | SETD5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-74109 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Rat |
| Antigen | Synthetic peptides corresponding to the N terminal of Setd5. Immunizing peptide sequence ETVPTWCPCGLSQDGFLLNCDKCRGMSRGKVIRLHRRKQDNISGGDSSAT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SETD5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SETD5 Antibody [NBP1-74109] - Rat Liver Lysate 1.0 ug/ml, gel concentration 6-18%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22716_SETD5%2520Antibody-Western%2520Blot-NBP1-74109-img0001.jpg)
Western Blot: SETD5 Antibody [NBP1-74109] - Rat Liver Lysate 1.0 ug/ml, gel concentration 6-18%