PPP2R5E Antibody

Name PPP2R5E Antibody
Supplier Novus Biologicals
Catalog NBP1-74173
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to the N terminal of Ppp2r5e. Immunizing peptide sequence SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Ppp2r5e
Conjugate Unconjugated
Supplier Page Shop

Product images