SEC14L3 Antibody

Name SEC14L3 Antibody
Supplier Novus Biologicals
Catalog NBP1-74169
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Rat
Antigen Synthetic peptides corresponding to the C terminal of Sec14l3. Immunizing peptide sequence RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Sec14l3
Conjugate Unconjugated
Supplier Page Shop

Product images