TSPAN17 Antibody

Name TSPAN17 Antibody
Supplier Novus Biologicals
Catalog NBP1-59771
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TSPAN17(tetraspanin 17) The peptide sequence was selected from the middle region of TSPAN17. Peptide sequence ELATGILAFVFKDWIRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TSPAN17
Conjugate Unconjugated
Supplier Page Shop

Product images