TSPAN17 Antibody

Name TSPAN17 Antibody
Supplier Novus Biologicals
Catalog NBP1-59770
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TSPAN17(tetraspanin 17) The peptide sequence was selected from the N terminal of TSPAN17. Peptide sequence GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TSPAN17
Conjugate Unconjugated
Supplier Page Shop

Product images