MOGAT1 Antibody
| Name | MOGAT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59769 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MOGAT1(monoacylglycerol O-acyltransferase 1) The peptide sequence was selected from the C terminal of MOGAT1. Peptide sequence PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MOGAT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MOGAT1 Antibody [NBP1-59769] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7315_MOGAT1-Antibody-Western-Blot-NBP1-59769-img0003.jpg)
![Western Blot: MOGAT1 Antibody [NBP1-59769] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7316_MOGAT1-Antibody-Western-Blot-NBP1-59769-img0002.jpg)