ANKH Antibody
| Name | ANKH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59748 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to ANKH(ankylosis, progressive homolog (mouse)) The peptide sequence was selected from the N terminal of ANKH (NP_473368). Peptide sequence SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ANKH |
| Supplier Page | Shop |
Product images
![Western Blot: ANKH Antibody [NBP1-59748] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9680_ANKH%2520Antibody-Western%2520Blot-NBP1-59748-img0003.jpg)
Western Blot: ANKH Antibody [NBP1-59748] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.