TCTN3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59741
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TCTN3(tectonic family member 3) The peptide sequence was selected from the middle region of TCTN3. Peptide sequence LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TCTN3
• Conjugate: Unconjugated

Product images

Western Blot: TCTN3 Antibody [NBP1-59741] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Immunohistochemistry: TCTN3 Antibody [NBP1-59741] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Plasma membrane and cytoplasm in hepatocytes Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: TCTN3 Antibody [NBP1-59741] - 721_B cell lysate, concentration 0.2-1 ug/ml.