PIGQ Antibody

Name PIGQ Antibody
Supplier Novus Biologicals
Catalog NBP1-59740
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PIGQ(phosphatidylinositol glycan anchor biosynthesis, class Q) The peptide sequence was selected from the N terminal of PIGQ. Peptide sequence PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PIGQ
Conjugate Unconjugated
Supplier Page Shop

Product images