ZDHHC16 Antibody

Name ZDHHC16 Antibody
Supplier Novus Biologicals
Catalog NBP1-59737
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZDHHC16(zinc finger, DHHC-type containing 16) The peptide sequence was selected from the C terminal of ZDHHC16. Peptide sequence VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZDHHC16
Conjugate Unconjugated
Supplier Page Shop

Product images