FMO5 Antibody
| Name | FMO5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59731 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FMO5(flavin containing monooxygenase 5) The peptide sequence was selected from the middle region of FMO5. Peptide sequence NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FMO5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FMO5 Antibody [NBP1-59731] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24899_FMO5-Antibody-Western-Blot-NBP1-59731-img0002.jpg)
Western Blot: FMO5 Antibody [NBP1-59731] - Hela cell lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: FMO5 Antibody [NBP1-59731] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24900_FMO5%2520Antibody-Immunohistochemistry-NBP1-59731-img0003.jpg)
Immunohistochemistry: FMO5 Antibody [NBP1-59731] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.