SFXN3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59728
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SFXN3(sideroflexin 3) The peptide sequence was selected from the middle region of SFXN3. Peptide sequence TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SFXN3
• Conjugate: Unconjugated

Product images

Western Blot: SFXN3 Antibody [NBP1-59728] - Titration: 0.2-1 ug/ml, Positive Control: CCRF-CEM cell lysate.