USP48 Antibody

Name USP48 Antibody
Supplier Novus Biologicals
Catalog NBP1-59752
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to USP48(ubiquitin specific peptidase 48) The peptide sequence was selected from the middle region of USP48. Peptide sequence ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene USP48
Conjugate Unconjugated
Supplier Page Shop

Product images