SLC7A4 Antibody

Name SLC7A4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59750
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC7A4(solute carrier family 7 (cationic amino acid transporter, y+ system), member 4) The peptide sequence was selected from the middle region of SLC7A4. Peptide sequence GAYILVSTVLTLMVPWHSLDPDSALADAFYQ
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC7A4
Conjugate Unconjugated
Supplier Page Shop

Product images