FNDC4 Antibody

Name FNDC4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59690
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Bovine, Dog, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to FNDC4(fibronectin type III domain containing 4) The peptide sequence was selected from the middle region of FNDC4. Peptide sequence EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene FNDC4
Supplier Page Shop

Product images