Name | FNDC4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59690 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Bovine, Dog, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to FNDC4(fibronectin type III domain containing 4) The peptide sequence was selected from the middle region of FNDC4. Peptide sequence EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS. |
Purity/Format | Affinity purified |
Description | Rabbit Polyclonal |
Gene | FNDC4 |
Supplier Page | Shop |