INSIG-2 Antibody
| Name | INSIG-2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59687 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to INSIG2(insulin induced gene 2) The peptide sequence was selected from the middle region of INSIG2. Peptide sequence WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | INSIG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: INSIG-2 Antibody [NBP1-59687] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml INSIG2 is supported by BioGPS gene expression data to be expressed in 721_B](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24850_INSIG-2-Antibody-Western-Blot-NBP1-59687-img0003.jpg)
![Western Blot: INSIG-2 Antibody [NBP1-59687] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24851_INSIG-2-Antibody-Western-Blot-NBP1-59687-img0002.jpg)