Name | Testican 3/SPOCK3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59686 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SPOCK3(sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3) The peptide sequence was selected from the middle region of SPOCK3. Peptide sequence CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKA |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SPOCK3 |
Conjugate | Unconjugated |
Supplier Page | Shop |