Testican 3/SPOCK3 Antibody

Name Testican 3/SPOCK3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59686
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SPOCK3(sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3) The peptide sequence was selected from the middle region of SPOCK3. Peptide sequence CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKA
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPOCK3
Conjugate Unconjugated
Supplier Page Shop

Product images