NGL-1/LRRC4C Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59669
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to LRRC4C(leucine rich repeat containing 4C) The peptide sequence was selected from the N terminal of LRRC4C. Peptide sequence LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: LRRC4C
• Conjugate: Unconjugated