SLC45A2 Antibody

Name SLC45A2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59786
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC45A2(solute carrier family 45, member 2) The peptide sequence was selected from the middle region of SLC45A2. Peptide sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC45A2
Conjugate Unconjugated
Supplier Page Shop

Product images