Name | SLC44A3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-91571 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptide directed towards the N terminal of human SLC44A3. Peptide sequence MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC44A3 |
Supplier Page | Shop |