SLC44A3 Antibody

Name SLC44A3 Antibody
Supplier Novus Biologicals
Catalog NBP1-91571
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptide directed towards the N terminal of human SLC44A3. Peptide sequence MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC44A3
Supplier Page Shop

Product images