ZBTB7C Antibody

Name ZBTB7C Antibody
Supplier Novus Biologicals
Catalog NBP1-91522
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ZBTB7C. Peptide sequence MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ZBTB7C
Conjugate Unconjugated
Supplier Page Shop

Product images