MINOS1 Antibody

Name MINOS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-91587
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human C1orf151. Peptide sequence IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MINOS1
Conjugate Unconjugated
Supplier Page Shop

Product images