NIPA2 Antibody
| Name | NIPA2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91580 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human NIPA2. Peptide sequence VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NIPA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NIPA2 Antibody [NBP1-91580] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24659_NIPA2-Antibody-Western-Blot-NBP1-91580-img0002.jpg)
Western Blot: NIPA2 Antibody [NBP1-91580] - 293T cells lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: NIPA2 Antibody [NBP1-91580] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and plasma membrane in hepatocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24660_NIPA2-Antibody-Immunohistochemistry-NBP1-91580-img0003.jpg)
Immunohistochemistry: NIPA2 Antibody [NBP1-91580] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and plasma membrane in hepatocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec