SEP15 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-91629
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the middle region of human SEP15The immunogen for this antibody is SEP15 (NP_004252). Peptide Sequence: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SEP15
• Conjugate: Unconjugated