Name | SALM4/LRFN3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-91348 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit |
Antigen | Synthetic peptide directed towards the C terminal of human LRFN3. Peptide sequence VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | LRFN3 |
Supplier Page | Shop |