xylosyltransferase 1 Antibody
| Name | xylosyltransferase 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91345 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
| Antigen | Synthetic peptide directed towards the middle region of human XYLT1. Peptide sequence RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | XYLT1 |
| Supplier Page | Shop |
Product images
![Western Blot: xylosyltransferase 1 Antibody [NBP1-91345] - PANC1 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9768_xylosyltransferase%25201%2520Antibody-Western%2520Blot-NBP1-91345-img0002.jpg)
Western Blot: xylosyltransferase 1 Antibody [NBP1-91345] - PANC1 cell lysate, concentration 0.2-1 ug/ml.