IGSF9 Antibody

Name IGSF9 Antibody
Supplier Novus Biologicals
Catalog NBP1-91340
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptide directed towards the N terminal of human IGSF9. Peptide sequence SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene IGSF9
Supplier Page Shop

Product images