TXNDC16 Antibody

Name TXNDC16 Antibody
Supplier Novus Biologicals
Catalog NBP1-91339
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human TXNDC16. Peptide sequence EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TXNDC16
Conjugate Unconjugated
Supplier Page Shop

Product images