Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-91328
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the C terminal of human HS6ST3. Peptide sequence TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: HS6ST3
• Conjugate: Unconjugated