TTYH3 Antibody

Name TTYH3 Antibody
Supplier Novus Biologicals
Catalog NBP1-91350
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human TTYH3. Peptide sequence IIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TTYH3
Conjugate Unconjugated
Supplier Page Shop

Product images