Kirrel1/NEPH1 Antibody

Name Kirrel1/NEPH1 Antibody
Supplier Novus Biologicals
Catalog NBP1-91309
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human KIRREL. Peptide sequence FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG.
Purity/Format Immunogen affinity purified
Blocking Peptide Kirrel1/NEPH1 Blocking Peptide
Description Rabbit Polyclonal
Gene KIRREL
Conjugate Unconjugated
Supplier Page Shop

Product images