Name | Kirrel1/NEPH1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-91309 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the middle region of human KIRREL. Peptide sequence FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG. |
Purity/Format | Immunogen affinity purified |
Blocking Peptide | Kirrel1/NEPH1 Blocking Peptide |
Description | Rabbit Polyclonal |
Gene | KIRREL |
Conjugate | Unconjugated |
Supplier Page | Shop |