KLHDC5 Antibody

Name KLHDC5 Antibody
Supplier Novus Biologicals
Catalog NBP1-91422
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptide directed towards the middle region of human KLHDC5. Peptide sequence IVGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene KLHL42
Supplier Page Shop

Product images