FIBCD1 Antibody

Name FIBCD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-91362
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptide directed towards the C terminal of human FIBCD1. Peptide sequence DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene FIBCD1
Supplier Page Shop

Product images