HDJ2 Antibody

Name HDJ2 Antibody
Supplier Novus Biologicals
Catalog NBP1-91453
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the N terminal of human Dnaja1. Peptide sequence YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Dnaja1
Conjugate Unconjugated
Supplier Page Shop

Product images