Galectin-4 Antibody

Name Galectin-4 Antibody
Supplier Novus Biologicals
Catalog NBP1-91560
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the C terminal of human Lgals4. Peptide sequence VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Lgals4
Conjugate Unconjugated
Supplier Page Shop

Product images