SIDT2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-91551
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human SIDT2. Peptide sequence LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SIDT2
• Conjugate: Unconjugated

Product images

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SIDT2 is supported by BioGPS gene expression data to be expressed in 721_B

Immunohistochemistry: SIDT2 Antibody [NBP1-91551] - R Paraffin Embedded Tissue: Human Placenta cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Western Blot: SIDT2 Antibody [NBP1-91551] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml SIDT2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml