PSMC1 Antibody
| Name | PSMC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91476 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PSMC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PSMC1 Antibody [NBP1-91476] - Lanes: 1: 10 ug proteasome fraction from C57B1/6J mouse brain, 2: 10 ug proteasome fraction from BLAB/C mouse brain Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000 Gene Name: Psmc1](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6887_PSMC1-Antibody-Western-Blot-NBP1-91476-img0003.jpg)
Western Blot: PSMC1 Antibody [NBP1-91476] - Lanes: 1: 10 ug proteasome fraction from C57B1/6J mouse brain, 2: 10 ug proteasome fraction from BLAB/C mouse brain Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000 Gene Name: Psmc1
![Western Blot: PSMC1 Antibody [NBP1-91476] - Mouse Brain lysate, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6888_PSMC1-Antibody-Western-Blot-NBP1-91476-img0002.jpg)
Western Blot: PSMC1 Antibody [NBP1-91476] - Mouse Brain lysate, concentration 1 ug/ml.