LANCL3 Antibody
| Name | LANCL3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91470 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human LANCL3. Peptide sequence ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LANCL3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LANCL3 Antibody [NBP1-91470] - ACHN cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15999_LANCL3%2520Antibody-Western%2520Blot-NBP1-91470-img0002.jpg)
Western Blot: LANCL3 Antibody [NBP1-91470] - ACHN cell lysate, concentration 0.2-1 ug/ml.