ARL2BP Antibody

Name ARL2BP Antibody
Supplier Novus Biologicals
Catalog NBP1-98397
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Antigen Synthetic peptide corresponding to mouse Arl2bp - C-terminal region (NP_077231). Peptide Sequence: LQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVT
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARL2BP
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.