Creatine kinase MT 1B Antibody (2C8)
| Name | Creatine kinase MT 1B Antibody (2C8) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001159-M04 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2C8 |
| Applications | WB ELISA Gene Silencing |
| Species Reactivities | Human |
| Antigen | CKMT1B (NP_066270 327 a.a. - 417 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | CKMT1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Analysis of CKMT1B expression in A-431 (Cat # L015V1).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/18155_Creatine-kinase-MT-1B-Antibody-(2C8)-Western-Blot-H00001159-M04-img0005.jpg)
Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Analysis of CKMT1B expression in A-431 (Cat # L015V1).
![Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed H00001159-M04. GAPDH (36.1 kDa) used as loading control.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/18156_Creatine-kinase-MT-1B-Antibody-(2C8)-Western-Blot-H00001159-M04-img0003.jpg)
Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed H00001159-M04. GAPDH (36.1 kDa) used as loading control.
![Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody (M04), clone 2C8. Lane 1: CKMT1B transfected lysatE (47 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/18157_Creatine%2520kinase%2520MT%25201B%2520Antibody%2520(2C8)-Western%2520Blot-H00001159-M04-img0006.jpg)
Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody (M04), clone 2C8. Lane 1: CKMT1B transfected lysatE (47 KDa). Lane 2: Non-transfected lysate.
![ELISA: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Detection limit for recombinant GST tagged CKMT1B is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/18158_Creatine-kinase-MT-1B-Antibody-(2C8)-ELISA-H00001159-M04-img0004.jpg)
ELISA: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Detection limit for recombinant GST tagged CKMT1B is approximately 0.1ng/ml as a capture antibody.