| Name | CDX4 Antibody (2H7) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001046-M11 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2H7 |
| Applications | WB ELISA |
| Species Reactivities | Human, Rat |
| Antigen | CDX4 (NP_005184 202 a.a. - 284 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE* |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | CDX4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |