Name | CDX4 Antibody (2H7) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00001046-M11 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 2H7 |
Applications | WB ELISA |
Species Reactivities | Human, Rat |
Antigen | CDX4 (NP_005184 202 a.a. - 284 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE* |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | CDX4 |
Conjugate | Unconjugated |
Supplier Page | Shop |